Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP010242HU(A4)-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research areas |
Epigenetics and Nuclear Signaling |
Target / Protein |
HDAC6 |
Biologically active |
Not Test |
Expression system |
E.coli |
Species of origin |
Homo sapiens (Human) |
Uniprot ID |
Q9UBN7 |
AA Sequence |
MMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRC LTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRE LHRESSNFDSIYICPSTFACAQLATGAACRLVEAV LSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAV AARHAQTISGHALRILIVDWDVHHGNGTQHMFEDD PSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTG FTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPE LVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMG LASGRIILILEGGYNLTSISESMAACTRSLLGDPP PLLTLPRPPLSGALASITETIQVHRRYWRSLRVMK VE |
Tag Info |
N-terminal 6xHis-tagged |
Expression Region |
489-840aa |
Protein length |
Partial |
MW |
42.4 kDa |
Relevance |
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.By similarity3 Publications In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins: when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome. Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggresome, facilitating their clearance by autophagy. |
References |
"Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 5:355-364(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. |
Involvement in disease |
Chondrodysplasia with platyspondyly, distinctive brachydactyly, hydrocephaly, and microphthalmia (CDP-PBHM) |
Subcellular Location |
Nucleus, Cytoplasm, Perikaryon, Cell projection, dendrite, Cell projection, axon |
Protein Families |
Histone deacetylase family, HD type 2 subfamily |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.