Comparison

Recombinant Human Histone deacetylase 6(HDAC6),Partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP010242HU(A4)-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRC LTLTPRPATEAELLTCHSAEYVGHLRATEKMKTRE LHRESSNFDSIYICPSTFACAQLATGAACRLVEAV LSGEVLNGAAVVRPPGHHAEQDAACGFCFFNSVAV AARHAQTISGHALRILIVDWDVHHGNGTQHMFEDD PSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTG FTVNVAWNGPRMGDADYLAAWHRLVLPIAYEFNPE LVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMG LASGRIILILEGGYNLTSISESMAACTRSLLGDPP PLLTLPRPPLSGALASITETIQVHRRYWRSLRVMK VE
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q9UBN7
Gene Names
HDAC6
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
489-840aa
MW of Fusion Proten
54, 4
Sequence Info
Partial
Relevance
Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes (By similarity). Plays a central role in microtubule-dependent cell motility via deacetylation of tubulin. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer.By similarity3 Publications In addition to its protein deacetylase activity, plays a key role in the degradation of misfolded proteins: when misfolded proteins are too abundant to be degraded by the chaperone refolding system and the ubiquitin-proteasome, mediates the transport of misfolded proteins to a cytoplasmic juxtanuclear structure called aggresome. Probably acts as an adapter that recognizes polyubiquitinated misfolded proteins and target them to the aggresome, facilitating their clearance by autophagy.
Reference
"Prediction of the coding sequences of unidentified human genes. XII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 5:355-364(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close