Comparison

Recombinant Saccharomyces cerevisiae Hexokinase-1(HXK1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Item no. CSB-EP010468SVG-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P04806
Gene Names
HXK1
Organism
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
AA Sequence
VHLGPKKPQARKGSMADVPKELMDEIHQLEDMFTV DSETLRKVVKHFIDELNKGLTKKGGNIPMIPGWVM EFPTGKESGNYLAIDLGGTNLRVVLVKLSGNHTFD TTQSKYKLPHDMRTTKHQEELWSFIADSLKDFMVE QELLNTKDTLPLGFTFSYPASQNKINEGILQRWTK GFDIPNVEGHDVVPLLQNEISKRELPIEIVALIND TVGTLIASYYTDPETKMGVIFGTGVNGAFYDVVSD IEKLEGKLADDIPSNSPMAINCEYGSFDNEHLVLP RTKYDVAVDEQSPRPGQQAFEKMTSGYYLGELLRL VLLELNEKGLMLKDQDLSKLKQPYIMDTSYPARIE DDPFENLEDTDDIFQKDFGVKTTLPERKLIRRLCE LIGTRAARLAVCGIAAICQKRGYKTGHIAADGSVY NKYPGFKEAAAKGLRDIYGWTGDASKDPITIVPAE DGSGAGAAVIAALSEKRIAEGKSLGIIGA
Expression Region
2-485aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
57.6 kDa
Alternative Name
Hexokinase PIHexokinase-A
Reference
Global analysis of Cdk1 substrate phosphorylation sites provides insights into evolution.Holt L.J., Tuch B.B., Villen J., Johnson A.D., Gygi S.P., Morgan D.O.Science 325:1682-1686(2009)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €246.81
Price: €246.81
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close