Comparison

Recombinant Human HLA class I histocompatibility antigen, alpha chain G protein(HLAG)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Item no. CSB-EP010509HUa2-200
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Immunology
Uniprot ID
P17693
Gene Names
HLA-G
Organism
Homo sapiens (Human)
AA Sequence
GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVR FDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAH AQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS DGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAA QISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENG KEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYP AEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWA AVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLP TIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Expression Region
25-338aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
51.6 kDa
Alternative Name
HLA G antigen. MHC class I antigen G
Relevance
Involved in the presentation of foreign antigens to the immune syst. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.
Reference
Homo sapiens 2, 229, 817bp genomic DNA of 6p21.3 HLA class I region.Shiina S., Tamiya G., Oka A., Inoko H.Disulfide bond-mediated dimerization of HLA-G on the cell surface.Boyson J.E., Erskine R., Whitman M.C., Chiu M., Lau J.M., Koopman L.A., Valter M.M., Angelisova P., Horejsi V., Strominger J.L.Proc. Natl. Acad. Sci. U.S.A. 99:16180-16185(2002)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.
Subcellular Location
Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 4: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 5: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted, SUBCELLULAR LOCATION: Isoform 7: Secreted
Protein Families
MHC class I family
Tissue Specificity
Expressed in trophoblasts. Expressed in fetal eye and thymus (PubMed:2336406). Also expressed in adult eye (PubMed:1570318). Isoform 4: Expressed in fetal first trimester trophoblasts (PubMed:7589701). Isoform 7: Expressed in first trimester, second trimester and term placenta, fetal liver, amniotic membrane, skin, cord blood and peripheral blood mononuclear cells (PubMed:11137219).
Paythway
Cellularsenescence
Amount: 200ug
Available: In stock
Listprice: €628.34
Price: €628.34
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close