Comparison

Recombinant Mouse 3-hydroxy-3-methylglutaryl-coenzyme A reductase (Hmgcr),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Item no. CSB-EP010565MO1-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cardiovascular
Uniprot ID
Q01237
Gene Names
Hmgcr
Organism
Mus musculus (Mouse)
AA Sequence
GRGKTVVCEAVIPAKVVREVLKTTTEAMVDVNINK NLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQ NVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTV GGGTNLLPQQACLQMLGVQGACKDNPGENARQLAR IVCGTVMAGELSLMAALAAGH
Expression Region
700-860aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
20.4 kDa
Relevance
Transmembrane glycoprotein that is the rate-limiting enzyme in cholesterol biosynthesis as well as in the biosynthesis of nonsterol isoprenoids that are essential for normal cell function including ubiquinone and geranylgeranyl proteins.
Reference
"Glucocorticoid-regulated gene expression in the immune system. Analysis of glucocorticoid-regulated transcripts from the mouse macrophage-like cell line P388D1."
Helmberg A., Faessler R., Geley S., Joehrer K., Kroemer G., Boeck G., Kofler R.
J. Immunol. 145:4332-4337(1990)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close