Recombinant Human High mobility group nucleosome-binding domain-containing protein 4(HMGN4)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP010576HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O00479
Gene Names
HMGN4
Organism
Homo sapiens (Human)
AA Sequence
MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPP KPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPA KNRDASTLQSQKAEGTGDAK
Expression Region
1-90aa
Sequence Info
Full Length
Tag Info
N-terminal GST-tagged
MW
36.5 kDa
Relevance
Non-histone chromosomal protein HMG-17-like 3
Reference
"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close