Comparison

Recombinant Mouse Heme oxygenase 1(Hmox1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 200ug
Item no. CSB-EP010583MO-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Cell Biology
Uniprot ID
P14901
Gene Names
Hmox1
Organism
Mus musculus (Mouse)
AA Sequence
MERPQPDSMPQDLSEALKEATKEVHIQAENAEFMK NFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQ NPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEII PCTPATQHYVKRLHEVGRTHPELLVAHAYTRYLGD LSGGQVLKKIAQKAMALPSSGEGLAFFTFPNIDSP TKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLN IELFEELQVMLTEEHKDQSPSQMASLRQRPASLVQ DTAPAETPRGKPQISTSSSQTPLLQWVLTLSFLLA TVAVGIYAM
Expression Region
1-289aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal 6xHis-B2M-tagged
MW
46.9 kDa
Alternative Name
P32 protein
Relevance
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. Exhibits cytoprotective effects since excess of free heme sensitizes cells to undergo apoptosis.
Reference
"Isolation and characterization of a complementary DNA clone for a Mr 32, 000 protein which is induced with tumor promoters in BALB/c 3T3 cells."
Kageyama H., Hiwasa T., Tokunaga K., Sakiyama S.
Cancer Res. 48:4795-4798(1988)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 200ug
Available: In stock
Listprice: €780.22
Price: €780.22
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close