Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP010609HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Transcription |
Uniprot ID |
P31943 |
Gene Names |
HNRNPH1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKI QNGAQGIRFIYTREGRPSGEAFVELESEDEVKLAL KKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPD TANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGI TLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERI GHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYD RPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDY NGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGS TFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPVR VHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKAN MQHRYVELFLNSTAGASGGAYEHRYVELFLNSTAG ASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYG GGYGGQSSMSGYDQVLQENSSDFQSNIA |
Expression Region |
2-449aa |
Sequence Info |
Full Length of Mature Protein |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
65.1 kDa |
Relevance |
This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG). |
Reference |
Heterogeneous nuclear ribonucleoproteins H, H', and F are members of a ubiquitously expressed subfamily of related but distinct proteins encoded by genes mapping to different chromosomes.Honore B., Rasmussen H.H., Vorum H., Dejgaard K., Liu X., Gromov P., Madsen P., Gesser B., Tommerup N., Celis J.E.J. Biol. Chem. 270:28780-28789(1995) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG). |
Subcellular Location |
Nucleus, nucleoplasm |
Tissue Specificity |
Expressed ubiquitously. |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.