Comparison

Recombinant Human Heterogeneous nuclear ribonucleoprotein H(HNRNPH1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP010609HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
MLGTEGGEGFVVKVRGLPWSCSADEVQRFFSDCKI QNGAQGIRFIYTREGRPSGEAFVELESEDEVKLAL KKDRETMGHRYVEVFKSNNVEMDWVLKHTGPNSPD TANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNGI TLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERI GHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPYD RPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDY NGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGGS TFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPVR VHIEIGPDGRVTGEADVEFATHEDAVAAMSKDKAN MQHRYVELFLNSTAGASGGAYEHRYVELFLNSTAG ASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGYG GGYGGQSSMSGYDQVLQENSSDFQSNIA
Research Topic
Transcription
Uniprot ID
P31943
Gene Names
HNRNPH1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-449aa
MW of Fusion Proten
65, 1
Sequence Info
Full Length
Relevance
This protein is a component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complexes which provide the substrate for the processing events that pre-mRNAs undergo before becoming functional, translatable mRNAs in the cytoplasm. Mediates pre-mRNA alternative splicing regulation. Inhibits, together with CUGBP1, insulin receptor (IR) pre-mRNA exon 11 inclusion in myoblast. Binds to the IR RNA. Binds poly(RG).
Reference
Heterogeneous nuclear ribonucleoproteins H, H', and F are members of a ubiquitously expressed subfamily of related but distinct proteins encoded by genes mapping to different chromosomes.Honore B., Rasmussen H.H., Vorum H., Dejgaard K., Liu X., Gromov P., Madsen P., Gesser B., Tommerup N., Celis J.E.J. Biol. Chem. 270:28780-28789(1995)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close