Comparison

Recombinant Human Heterogeneous nuclear ribonucleoprotein M(HNRNPM)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Item no. CSB-EP010613HUa2-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P52272
Gene Names
HNRNPM
Organism
Homo sapiens (Human)
AA Sequence
AAGVEAAAEVAATEIKMEEESGAPGVPSGNGAPGP KGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRY RAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMD AEGKSRGCAVVEFKMEESMKKAAEVLNKHSLSGRP LKVKEDPDGEHARRAMQKVMATTGGMGMGPGGPGM ITIPPSILNNPNIPNEIIHALQAGRLGSTVFVANL DYKVGWKKLKEVFSMAGVVVRADILEDKDGKSRGI GTVTFEQSIEAVQAISMFNGQLLFDRPMHVKMDER ALPKGDFFPPERPQQLPHGLGGIGMGLGPGGQPID ANHLNKGIGMGNIGPAGMGMEGIGFGINKMGGMEG PFGGGMENMGRFGSGMNMGRINEILSNALKRGEII AKQGGGGGGGSVPGIERMGPGIDRLGGAGMERMGA GLGHGMDRVGSEIERMGLVMDRMGSVERMGSGIER MGPLGLDHMASSIERMGQTMERIGSGVERMGAGMG FGLERMAAPIDRVGQTIERMGSGVERMGPAIERMG LSMERMVPAGMGAGLERMGPVMDRMATGLERMGAN NLERMGLERMGANSLERMGLERMGANSLERMGPAM GPALGAGIERMGLAMGGGGGASFDRAIEMERGNFG GSFAGSFGGAGGHAPGVARKACQIFVRNLPFDFTW KMLKDKFNECGHVLYADIKMENGKSKGCGVVKFES PEVAERACRMMNGMKLSGREIDVRIDRNA
Expression Region
2-730aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
93.4 kDa
Relevance
Pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. Involved in splicing. Acts as a receptor for carcinobryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines.
Reference
Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features.Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close