Comparison

Recombinant Rat Hemopexin(Hpx)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP010723RA-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
P20059
Gene Names
Hpx
Organism
Rattus norvegicus (Rat)
AA Sequence
NPLPAAHETVAKGENGTKPDSDVIEHCSDAWSFDA TTMDHNGTMLFFKGEFVWRGHSGIRELISERWKNP VTSVDAAFRGPDSVFLIKEDKVWVYPPEKKENGYP KLFQEEFPGIPYPPDAAVECHRGECQSEGVLFFQG NRKWFWDFATRTQKERSWPAVGNCTAALRWLERYY CFQGNKFLRFNPVTGEVPPRYPLDARDYFISCPGR GHGKLRNGTAHGNSTHPMHSRCNADPGLSALLSDH RGATYAFSGSHYWRLDSSRDGWHSWPIAHHWPQGP SAVDAAFSWDEKVYLIQGTQVYVFLTKGGNNLVSG YPKRLEKELGSPPGISLDTIDAAFSCPGSSKLYVT SGRRLWWLDLKSGAQATWAELSWPHEKVDGALCLE KSLGPYSCSSNGPNLFFIHGPNLYCYSSIDKLNAA KSLPQPQKVNSILGCSQ
Expression Region
24-460aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
52.9 kDa
Relevance
Binds he and transports it to the liver for breakdown and iron recovery, after which the free hopexin returns to the circulation.
Reference
Rat hemopexin. Molecular cloning, primary structural characterization, and analysis of gene expression.Nikkilae H., Gitlin J.D., Mueller-Eberhard U.Biochemistry 30:823-829(1991)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Binds heme and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation.
Subcellular Location
Secreted
Protein Families
Hemopexin family
Tissue Specificity
Expressed by the liver and secreted in plasma.
Amount: 10ug
Available: In stock
Listprice: €230.66
Price: €230.66
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close