Recombinant Human Heat shock protein HSP 90-beta(HSP90AB1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
ArtNr CSB-EP010808HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P08238
Gene Names
HSP90AB1
Organism
Homo sapiens (Human)
AA Sequence
PEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNK EIFLRELISNASDALDKIRYESLTDPSKLDSGKEL KIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIA KSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAE KVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIG RGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGY PITLYLEKEREKEISDDEAEEEKGEKEEEDKDDEE KPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEE LNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHL AVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKN NIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDL PLNISREMLQQSKILKVIRKNIVKKCLELFSELAE DKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLR YHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESK EQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLK EFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFE NLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTY GWTANMERIMKAQALRDNSTMGYMMAKKHLEINPD HPIVETLRQKAEADKNDKAVKDLVVLLFETALLSS GFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPN AAVPDEIPPLEGDEDASRMEEVD
Expression Region
2-724aa
Sequence Info
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW
88.1 kDa
Alternative Name(s)
Heat shock 84KDA
Relevance
Molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.
Reference
"Heat-shock proteins, Hsp84 and Hsp86, of mice and men: two related genes encode formerly identified tumour-specific transplantation antigens."
Hoffmann T., Hovemann B.
Gene 74:491-501(1988)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €140.00
Price: €140.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close