Comparison

Recombinant Mouse Heat shock 70 kDa protein 1B(Hspa1b)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP010822MO-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Heat shock 70 kDa protein 1
Short name:
HSP70.1
AA Sequence
AKNTAIGIDLGTTYSCVGVFQHGKVEIIANDQGNR TTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAK RLIGRKFGDAVVQSDMKHWPFQVVNDGDKPKVQVN YKGESRSFFPEEISSMVLTKMKEIAEAYLGHPVTN AVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEP TAAAIAYGLDRTGKGERNVLIFDLGGGTFDVSILT IDDGIFEVKATAGDTHLGGEDFDNRLVSHFVEEFK RKHKKDISQNKRAVRRLRTACERAKRTLSSSTQAS LEIDSLFEGIDFYTSITRARFEELCSDLFRGTLEP VEKALRDAKMDKAQIHDLVLVGGSTRIPKVQKLLQ DFFNGRDLNKSINPDEAVAYGAAVQAAILMGDKSE NVQDLLLLDVAPLSLGLETAGGVMTALIKRNSTIP TKQTQTFTTYSDNQPGVLIQVYEGERAMTRDNNLL GRFELSGIPPAPRGVPQIEVTFDIDANGILNVTAT DKSTGKANKITITNDKGRLSKEEIERMVQEAERYK AEDEVQRDRVAAKNALESYAFNMKSAVEDEGLKGK LSEADKKKVLDKCQEVISWLDSNTLADKEEFVHKR EELERVCSPIISGLYQGAGAPGAGGFGAQAPPKGA SGSGPTIEEVD
Research Topic
Others
Uniprot ID
P17879
Gene Names
Hspa1b
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-642aa
MW of Fusion Proten
86
Sequence Info
Full Length
Relevance
In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage. Essential for STUB1-mediated ubiquitination and degradation of FOXP3 in regulatory T-cells (Treg) during inflammation.
Reference
"Characterization and sequence of a mouse hsp70 gene and its expression in mouse cell lines."Hunt C., Calderwood S.Gene 87:199-204(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close