Comparison

Recombinant Human Checkpoint protein HUS1(HUS1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP010909HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
KFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISP DKLNFILCDKLANGGVSMWCELEQENFFNEFQMEG VSAENNEIYLELTSENLSRALKTAQNARALKIKLT NKHFPCLTVSVELLSMSSSSRIVTHDIPIKVIPRK LWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNI SNHLVIEANLDGELNLKIETELVCVTTHFKDLGNP PLASESTHEDRNVEHMAEVHIDIRKLLQFLAGQQV NPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
O60921
Gene Names
HUS1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-280aa
MW of Fusion Proten
47, 6
Sequence Info
Partial
Relevance
Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair. The 9-1-1 complex is recruited to DNA lesion upon damage by the RAD17-replication factor C (RFC) clamp loader complex. Acts then as a sliding clamp platform on DNA for several proteins involved in long-patch base excision repair (LP-BER). The 9-1-1 complex stimulates DNA polymerase beta (POLB) activity by increasing its affinity for the 3'-OH end of the primer-tplate and stabilizes POLB to those sites where LP-BER proceeds; endonuclease FEN1 cleavage activity on substrates with double, nick, or gap flaps of distinct sequences and lengths; and DNA ligase I (LIG1) on long-patch base excision repair substrates. The 9-1-1 complex is necessary for the recruitment of RHNO1 to sites of double-stranded breaks (DSB) occurring during the S phase.
Reference
Hus1p, a conserved fission yeast checkpoint protein, interacts with Rad1p and is phosphorylated in response to DNA damage.Kostrub C.F., Knudsen K., Subramani S., Enoch T.EMBO J. 17:2055-2066(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close