Comparison

Recombinant Human Islet cell autoantigen 1(ICA1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP010947HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
69 kDa islet cell autoantigen ; ICA69Islet cell autoantigen p69 ; ICAp69 ; p69
AA Sequence
MSGHKCSYPWDLQDRYAQDKSVVNKMQQKYWETKQ AFIKATGKKEDEHVVASDADLDAKLELFHSIQRTC LDLSKAIVLYQKRICFLSQEENELGKFLRSQGFQD KTRAGKMMQATGKALCFSSQQRLALRNPLCRFHQE VETFRHRAISDTWLTVNRMEQCRTEYRGALLWMKD VSQELDPDLYKQMEKFRKVQTQVRLAKKNFDKLKM DVCQKVDLLGASRCNLLSHMLATYQTTLLHFWEKT SHTMAAIHESFKGYQPYEFTTLK
Research Topic
Neuroscience
Uniprot ID
Q05084
Gene Names
ICA1
Tag Info
N-terminal 6xHis-tagged
Expression Region
1-268aa
MW of Fusion Proten
35, 5
Sequence Info
Partial
Relevance
May play a role in neurotransmitter secretion.
Reference
The DNA sequence of human chromosome 7.Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. , Nash W.E., Cordes M., Du H., Sun H., Edwards J., Bradshaw-Cordum H., Ali J., Andrews S., Isak A., Vanbrunt A., Nguyen C., Du F., Lamar B., Courtney L., Kalicki J., Ozersky P., Bielicki L., Scott K., Holmes A., Harkins R., Harris A., Strong C.M., Hou S., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Leonard S., Rohlfing T., Rock S.M., Tin-Wollam A.-M., Abbott A., Minx P., Maupin R., Strowmatt C., Latreille P., Miller N., Johnson D., Murray J., Woessner J.P., Wendl M.C., Yang S.-P., Schultz B.R., Wallis J.W., Spieth J., Bieri T.A., Nelson J.O., Berkowicz N., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Bedell J.A., Mardis E.R., Clifton S.W., Chissoe S.L., Marra M.A., Raymond C., Haugen E., Gillett W., Zhou Y., James R., Phelps K., Iadanoto S., Bubb K., Simms E., Levy R., Clendenning J., Kaul R., Kent W.J., Furey T.S., Baertsch R.A., Brent M.R., Keibler E., Flicek P., Bork P., Suyama M., Bailey J.A., Portnoy M.E., Torrents D., Chinwalla A.T., Gish W.R., Eddy S.R., McPherson J.D., Olson M.V., Eichler E.E., Green E.D., Waterston R.H., Wilson R.K.Nature 424:157-164(2003)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close