Comparison

Recombinant Mouse Isocitrate dehydrogenase [NADP] Cytoplasmic domain(Idh1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP010989MO-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
O88844
Gene Names
Idh1
Organism
Mus musculus (Mouse)
AA Sequence
GGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHS YDLGIENRDATNDQVTKDAAEAIKKYNVGVKCATI TPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREA IICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVV PGPGKVEITYTPKDGTQKVTYMVHDFEEGGGVAMG MYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTIL KKYDGRFKDIFQEIYDKKYKSQFEAQKICYEHRLI DDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYG SLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMYQK GQETSTNPIASIFAWSRGLAHRAKLDNNTELSFFA KALEDVCIETIEAGFMTKDLAACIKGLPNVQRSDY LNTFEFMDKLGENLKA
Expression Region
7-407aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
49.2 kDa
Alternative Name
Cytosolic NADP-isocitrate dehydrogenaseIDPNADP(+)-specific ICDHOxalosuccinate decarboxylase
Reference
Label-free quantitative proteomics of the lysine acetylome in mitochondria identifies substrates of SIRT3 in metabolic pathways.Rardin M.J., Newman J.C., Held J.M., Cusack M.P., Sorensen D.J., Li B., Schilling B., Mooney S.D., Kahn C.R., Verdin E., Gibson B.W.Proc. Natl. Acad. Sci. U.S.A. 110:6601-6606(2013)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location
Cytoplasm
Protein Families
Isocitrate and isopropylmalate dehydrogenases family
Amount: 10ug
Available: In stock
Listprice: €230.66
Price: €230.66
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close