Comparison

Recombinant Human Alpha-L-iduronidase(IDUA)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP011000HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P35475
Gene Names
IDUA
Organism
Homo sapiens (Human)
AA Sequence
APHLVHVDAARALWPLRRFWRSTGFCPPLPHSQAD QYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELV TTRGSTGRGLSYNFTHLDGYLDLLRENQLLPGFEL MGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRY GLAHVSKWNFETWNEPDHHDFDNVSMTMQGFLNYY DACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGL LRHCHDGTNFFTGEAGVRLDYISLHRKGARSSISI LEQEKVVAQQIRQLFPKFADTPIYNDEADPLVGWS LPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFP YALLSNDNAFLSYHPHPFAQRTLTARFQVNNTRPP HVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVL DSNHTVGVLASAHRPQGPADAWRAAVLIYASDDTR AHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGLCS PDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRP LPAGGRLTLRPALRLPSLLLVHVCARPEKPPGQVT RLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQ DGKAYTPVSRKPSTFNLFVFSPDTGAVSGSYRVRA LDYWARPGPFSDPVPYLEVPVPRGPPSPGNP
Expression Region
28-653aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
73.9 kDa
Reference
Human alpha-L-iduronidase uses its own N-glycan as a substrate-binding and catalytic module.Maita N., Tsukimura T., Taniguchi T., Saito S., Ohno K., Taniguchi H., Sakuraba H.Proc. Natl. Acad. Sci. U.S.A. 110:14628-14633(2013)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Involvement in disease
Mucopolysaccharidosis 1H (MPS1H); Mucopolysaccharidosis 1H/S (MPS1H/S); Mucopolysaccharidosis 1S (MPS1S)
Subcellular Location
Lysosome
Protein Families
Glycosyl hydrolase 39 family
Tissue Specificity
Ubiquitous.
Amount: 10ug
Available: In stock
Listprice: €175.45
Price: €175.45
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close