Comparison

Recombinant Human Interferon alpha-inducible protein 6(IFI6)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP011016HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cell Biology
Uniprot ID
P09912
Gene Names
IFI6
Organism
Homo sapiens (Human)
AA Sequence
GKKKCSESSDSGSGFWKALTFMAVGGGLAVAGLPA LGFTGAGIAANSVAASLMSWSAILNGGGVPAGGLV ATLQSLGAGGSSVVIGNIGALMGYATHKYLDSEED EE
Expression Region
24-130aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-B2M-tagged
MW
24.4 kDa
Alternative Name
Interferon-induced protein 6-16
Reference
"Inhibition of G1P3 expression found in the differential display study on respiratory syncytial virus infection."
Zhao D., Peng D., Li L., Zhang Q., Zhang C.
Virol. J. 5:114-114(2008)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location
Membrane, Multi-pass membrane protein
Protein Families
IFI6/IFI27 family
Amount: 10ug
Available: In stock
Listprice: €175.45
Price: €175.45
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close