« Back
Home /
Recombinant Marmota monax Interferon gamma(IFNG)

Recombinant Marmota monax Interferon gamma(IFNG)

Manufacturer	Cusabio
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP011050MQG-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Others
Uniprot ID	O35735
Gene Names	IFNG
Organism	Marmota monax (Woodchuck)
AA Sequence	QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDK WKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSM DTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKI QRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRR ASK
Expression Region	24-166aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	20.6 kDa
Alternative Name(s)	Short name:IFN-gamma
Relevance	Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Reference	"Molecular cloning of the woodchuck cytokines: TNF-alpha, IFN-gamma, and IL-6."Lohrengel B., Lu M., Roggendorf M.Immunogenetics 47:332-335(1998)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Subcellular Location	Secreted
Protein Families	Type II (or gamma) interferon family
Tissue Specificity	Released primarily from activated T lymphocytes.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP011050MQG-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time