Comparison

Recombinant Marmota monax Interferon gamma(IFNG)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP011050MQG-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Alternative Name(s)
Short name:IFN-gamma
AA Sequence
QDTVNKEIEDLKGYFNASNSNVSDGGSLFLDILDK WKEESDKKVIQSQIVSFYFKLFEHLKDNKIIQRSM DTIKGDLFAKFFNSSTNKLQDFLKVSQVQVNDLKI QRKAVSELKKVMNDLLPHSTLRKRKRSQSSIRGRR ASK
Research Topic
Others
Uniprot ID
O35735
Gene Names
IFNG
Tag Info
N-terminal 6xHis-tagged
Expression Region
24-166aa
MW of Fusion Proten
20, 6
Sequence Info
Full Length
Relevance
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Reference
"Molecular cloning of the woodchuck cytokines: TNF-alpha, IFN-gamma, and IL-6."Lohrengel B., Lu M., Roggendorf M.Immunogenetics 47:332-335(1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Marmota monax (Woodchuck)
Amount: 10ug
Available: In stock
Listprice: €246.81
Price: €246.81
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close