Comparison

Recombinant Human Monoglyceride lipase(MGLL)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP013787HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
HU-K5
Lysophospholipase homolog
Lysophospholipase-like
Monoacylglycerol lipase
AA Sequence
MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYW KPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDL LVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVD SMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFA GMVLISPLVLANPESATTFKVLAAKVLNLVLPNLS LGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFG IQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSK GAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTN SVFHEINMWVSQRTATAGTASPP
Research Topic
Cardiovascular
Uniprot ID
Q99685
Gene Names
MGLL
Tag Info
N-terminal GST-tagged
Expression Region
1-303aa
MW of Fusion Proten
60, 3
Sequence Info
Full Length
Relevance
Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth
Reference
"A novel poxvirus gene and its human homolog are similar to an E. coli lysophospholipase."
Wall E.M., Cao J.X., Chen N., Buller R.M.L., Upton C.
Virus Res. 52:157-167(1997)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close