« Back
Home /
Recombinant Mouse Monoglyceride lipase(Mgll)

Recombinant Mouse Monoglyceride lipase(Mgll)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Amount	100ug
Host	E.coli
Item no.	CSB-EP013787MO-100
eClass 6.1	34160400
eClass 9.0	42020190
Available
Alternative Name(s)	Monoacylglycerol lipase
AA Sequence	MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYW KPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDM LVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVD TIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFS GMVLISPLVLANPESASTLKVLAAKLLNFVLPNMT LGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFG IQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSK GAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTN SVLHEVNSWVSHRIAAAGAGCPP
Research Topic	Cardiovascular
Uniprot ID	O35678
Gene Names	Mgll
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-303aa
MW of Fusion Proten	49, 4
Sequence Info	Full Length
Relevance	Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth
Reference	"Exon-intron organization and chromosomal localization of the mouse monoglyceride lipase gene." Karlsson M., Reue K., Xia Y.-R., Lusis A.J., Langin D., Tornqvist H., Holm C. Gene 272:11-18(2001)
Purity	Greater than 85% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species	Mus musculus (Mouse)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Request delivery time