Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Amount |
100ug |
Host |
E.coli |
Item no. |
CSB-EP013787MO-100 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Alternative Name(s) |
Monoacylglycerol lipase |
AA Sequence |
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYW KPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDM LVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVD TIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFS GMVLISPLVLANPESASTLKVLAAKLLNFVLPNMT LGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFG IQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSK GAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTN SVLHEVNSWVSHRIAAAGAGCPP |
Research Topic |
Cardiovascular |
Uniprot ID |
O35678 |
Gene Names |
Mgll |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Expression Region |
1-303aa |
MW of Fusion Proten |
49, 4 |
Sequence Info |
Full Length |
Relevance |
Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth |
Reference |
"Exon-intron organization and chromosomal localization of the mouse monoglyceride lipase gene." Karlsson M., Reue K., Xia Y.-R., Lusis A.J., Langin D., Tornqvist H., Holm C. Gene 272:11-18(2001) |
Purity |
Greater than 85% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Species |
Mus musculus (Mouse) |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.