Comparison

Recombinant Mouse Monoglyceride lipase(Mgll)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP013787MO-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Monoacylglycerol lipase
AA Sequence
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYW KPSGTPKALIFVSHGAGEHCGRYDELAHMLKGLDM LVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVD TIQKDYPDVPIFLLGHSMGGAISILVAAERPTYFS GMVLISPLVLANPESASTLKVLAAKLLNFVLPNMT LGRIDSSVLSRNKSEVDLYNSDPLVCRAGLKVCFG IQLLNAVARVERAMPRLTLPFLLLQGSADRLCDSK GAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTN SVLHEVNSWVSHRIAAAGAGCPP
Research Topic
Cardiovascular
Uniprot ID
O35678
Gene Names
Mgll
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-303aa
MW of Fusion Proten
49, 4
Sequence Info
Full Length
Relevance
Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth
Reference
"Exon-intron organization and chromosomal localization of the mouse monoglyceride lipase gene."
Karlsson M., Reue K., Xia Y.-R., Lusis A.J., Langin D., Tornqvist H., Holm C.
Gene 272:11-18(2001)
Purity
Greater than 85% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 100ug
Available: Out of stock
Listprice: €421.15
Price: €421.15
nicht lieferbar

Fragen Sie nach einem alternativen Produkt

Questions about this Product?
 
Close