Comparison

Recombinant Rat Multiple inositol polyphosphate phosphatase 1(Minpp1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP013831RA-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
2, 3-bisphosphoglycerate 3-phosphatase (EC:3.1.3.80) ; 2, 3-BPG phosphataseInositol (1, 3, 4, 5)-tetrakisphosphate 3-phosphatase ; Ins(1, 3, 4, 5)P(4) 3-phosphatase
AA Sequence
SLPGRGDPVASVLSPYFGTKTRYEDVNPWLLGDPV APRRDPELLAGTCTPVQLVALIRHGTRYPTTKQIR KLRQLQGLLQTRESVDGGSRVAAALDQWPLWYDDW MDGQLVEKGRQDMRQLALRLAALFPDLFCRENYGR LRLITSSKHRCVDSSAAFLQGLWQHYHPGLPPPDV SDMECDPPRVNDKLMRFFDHCEKFLTEVERNATAL YHVEAFKTGPEMQTVLKKVAATLQVPVNNLNADLI QVAFFTCSFDLAIQGVHSPWCDVFDVDDAKVLEYL NDLKQYWKRSYGYAINSRSSCNLFQDIFLHLDKAV EQKQRSQPVSSSVILQFGHAETLLPLLSLMGYFKD KEPLTAYNFEEQVHREFRSGHIVPYASNLIFVLYH CEDAQTPQEKFQIQMLLNEKVLPLAHSQKTVALYE DLKNHYQDILQSCQTSKECNLPKVNITSDEL
Research Topic
Others
Uniprot ID
O35217
Gene Names
Minpp1
Tag Info
N-terminal 6xHis-tagged
Expression Region
31-481aa
MW of Fusion Proten
55, 6
Sequence Info
Full Length
Relevance
Acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). Also acts as a 2, 3-bisphosphoglycerate 3-phosphatase, by mediating the dephosphorylation of 2, 3-bisphosphoglycerate (2, 3-BPG) to produce phospho-D-glycerate without formation of 3-phosphoglycerate. May play a role in bone development (endochondral ossification).
Reference
The human and rat forms of multiple inositol polyphosphate phosphatase functional homology with a histidine acid phosphatase up-regulated during endochondral ossification.Caffrey J.J., Hidaka K., Matsuda M., Hirata M., Shears S.B.FEBS Lett. 442:99-104(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Rattus norvegicus (Rat)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close