Comparison

Recombinant Human Myeloid leukemia factor 1(MLF1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP014621HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Myelodysplasia-myeloid leukemia factor 1
AA Sequence
MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSE PFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVS SFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSF CSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKET RKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKT GDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGR HNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEH GRRSNVLGDKLHIKGSSVKSNKK
Research Topic
others
Uniprot ID
P58340
Gene Names
MLF1
Tag Info
N-terminal GST-tagged
Expression Region
1-268aa
MW of Fusion Proten
57, 6
Sequence Info
Full Length
Relevance
Involved in lineage commitment of primary hemopoietic progenitors by restricting erythroid formation and enhancing myeloid formation. Interferes with erythropoietin-induced erythroid terminal differentiation by preventing cells from exiting the cell cycle through suppression of CDKN1B/p27Kip1 levels. Suppresses RFWD2/COP1 activity via CSN3 which activates p53 and induces cell cycle arrest. Binds DNA and affects the expression of a number of genes so may function as a transcription factor in the nucleus.
Reference
"The t(3; 5)(q25.1; q34) of myelodysplastic syndrome and acute myeloid leukemia produces a novel fusion gene, NPM-MLF1."
Yoneda-Kato N., Look A.T., Kirstein M.N., Valentine M.B., Raimondi S.C., Cohen K.J., Carroll A.J., Morris S.W.
Oncogene 12:265-275(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close