Comparison

Recombinant Human Modulator of apoptosis 1(MOAP1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP014693HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cell Biology
Uniprot ID
Q96BY2
Gene Names
MOAP1
Organism
Homo sapiens (Human)
AA Sequence
MTLRLLEDWCRGMDMNPRKALLIAGISQSCSVAEI EEALQAGLAPLGEYRLLGRMFRRDENRKVALVGLT AETSHALVPKEIPGKGGIWRVIFKPPDPDNTFLSR LNEFLAGEGMTVGELSRALGHENGSLDPEQGMIPE MWAPMLAQALEALQPALQCLKYKKLRVFSGRESPE PGEEEFGRWMFHTTQMIKAWQVPDVEKRRRLLESL RGPALDVIRVLKINNPLITVDECLQALEEVFGVTD NPRELQVKYLTTYQKDEEKLSAYVLRLEPLLQKLV QRGAIERDAVNQARLDQVIAGAVHKTIRRELNLPE DGPAPGFLQLLVLIKDYEAAEEEEALLQAILEGNF
Expression Region
1-351aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
66.5 kDa
Alternative Name
Paraneoplastic antigen Ma4
Relevance
Required for death receptor-dependent apoptosis. When associated with RASSF1, promotes BAX conformational change and translocation to mitochondrial membranes in response to TNF and TNFSF10 stimulation.
Reference
"MAP-1, a novel proapoptotic protein containing a BH3-like motif that associates with Bax through its Bcl-2 homology domains."
Tan K.O., Tan K.M.L., Chan S.-L., Yee K.S.Y., Bevort M., Ang K.C., Yu V.C.
J. Biol. Chem. 276:2802-2807(2001)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Required for death receptor-dependent apoptosis. When associated with RASSF1, promotes BAX conformational change and translocation to mitochondrial membranes in response to TNF and TNFSF10 stimulation.
Protein Families
PNMA family
Tissue Specificity
Widely expressed, with high levels in heart and brain.
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close