Comparison

Recombinant Escherichia coli Mannose-6-phosphate isomerase(manA)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP014754ENV-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
PhosphohexomutasePhosphomannose isomerase ; PMI
AA Sequence
MQKLINSVQNYAWGSKTALTELYGMENPSSQPMAE LWMGAHPKSSSRVQNAAGDIVSLRDVIESDKSTLL GEAVAKRFGELPFLFKVLCAAQPLSIQVHPNKHNS EIGFAKENAAGIPMDAAERNYKDPNHKPELVFALT PFLAMNAFREFSEIVSLLQPVAGAHPAIAHFLQQP DAERLSELFASLLNMQGEEKSRALAILKSALDSQQ GEPWQTIRLISEFYPEDSGLFSPLLLNVVKLNPGE AMFLFAETPHAYLQGVALEVMANSDNVLRAGLTPK YIDIPELVANVKFEAKPANQLLTQPVKQGAELDFP IPVDDFAFSLHDLSDKETTISQQSAAILFCVEGDA TLWKGSQQLQLKPGESAFIAANESPVTVKGHGRLA RVYNKL
Research Topic
Others
Uniprot ID
P00946
Gene Names
manA
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-391aa
MW of Fusion Proten
58, 8
Sequence Info
Full Length
Relevance
Involved in the conversion of glucose to GDP-L-fucose, which can be converted to L-fucose, a capsular polysaccharide.
Reference
Robison K., O'Keeffe T., Church G.M. Lysine acetylation is a highly abundant and evolutionarily conserved modification in Escherichia coli.Zhang J., Sprung R., Pei J., Tan X., Kim S., Zhu H., Liu C.F., Grishin N.V., Zhao Y.Mol. Cell. Proteomics 8:215-225(2009)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Escherichia coli (strain K12)
Amount: 100ug
Available: In stock
Listprice: €610.49
Price: €610.49
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close