« Back
Home /
Recombinant Human Mannose-6-phosphate isomerase(MPI)

Recombinant Human Mannose-6-phosphate isomerase(MPI)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP014754HU-50
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Signal Transduction
Uniprot ID	P34949
Gene Names	MPI
Organism	Homo sapiens (Human)
AA Sequence	AAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDP LAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTL SQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETP LSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIA LTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAA THLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVE QLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYP GDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKG DCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTP SSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTE VPGSVTEYKVLALDSASILLMVQGTVIASTPTTQT PIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACC LL
Expression Region	1-423aa
Sequence Info	Full Length
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	73.5 kDa
Alternative Name(s)	Phosphohexomutase Phosphomannose isomerase
Relevance	Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Reference	"Genomic organization of the human phosphomannose isomerase (MPI) gene and mutation analysis in patients with congenital disorders of glycosylation type Ib (CDG-Ib)." Schollen E., Dorland L., de Koning T.J., Van Diggelen O.P., Huijmans J.G.M., Marquardt T., Babovic-Vuksanovic D., Patterson M., Imtiaz F., Winchester B., Adamowicz M., Pronicka E., Freeze H., Matthijs G. Hum. Mutat. 16:247-252(2000)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Involvement in disease	Congenital disorder of glycosylation 1B (CDG1B)
Subcellular Location	Cytoplasm
Protein Families	Mannose-6-phosphate isomerase type 1 family
Tissue Specificity	Expressed in all tissues, but more abundant in heart, brain and skeletal muscle.
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP014754HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time