Comparison

Recombinant Human Mannose-6-phosphate isomerase(MPI)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP014754HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Phosphohexomutase
Phosphomannose isomerase
AA Sequence
AAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDP LAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTL SQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETP LSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIA LTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAA THLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVE QLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYP GDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKG DCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTP SSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTE VPGSVTEYKVLALDSASILLMVQGTVIASTPTTQT PIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACC LL
Research Topic
Signal Transduction
Uniprot ID
P34949
Gene Names
MPI
Tag Info
N-terminal GST-tagged
Expression Region
1-423aa
MW of Fusion Proten
73, 5
Sequence Info
Full Length
Relevance
Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
Reference
"Genomic organization of the human phosphomannose isomerase (MPI) gene and mutation analysis in patients with congenital disorders of glycosylation type Ib (CDG-Ib)."
Schollen E., Dorland L., de Koning T.J., Van Diggelen O.P., Huijmans J.G.M., Marquardt T., Babovic-Vuksanovic D., Patterson M., Imtiaz F., Winchester B., Adamowicz M., Pronicka E., Freeze H., Matthijs G.
Hum. Mutat. 16:247-252(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €199.38
Price: €199.38
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close