Comparison

Recombinant Human 39S ribosomal protein L12, mitochondrial(MRPL12)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP014817HU-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Tags & Cell Markers
Uniprot ID
P52815
Gene Names
MRPL12
Organism
Homo sapiens (Human)
AA Sequence
EALAGAPLDNAPKEYPPKIQQLVQDIASLTLLEIS DLNELLKKTLKIQDVGLVPMGGVMSGAVPAAAAQE AVEEDIPIAKERTHFTVRLTEAKPVDKVKLIKEIK NYIQGINLVQAKKLVESLPQEIKANVAKAEAEKIK AALEAVGGTVVLE
Expression Region
1-198aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
43.4 kDa
Alternative Name
5c5-2
Reference
"A delayed-early response nuclear gene encoding MRPL12, the mitochondrial homologue to the bacterial translational regulator L7/L12 protein."
Marty L., Fort P.
J. Biol. Chem. 271:11468-11476(1996)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Associates with mitochondrial RNA polymerase to activate transcription.
Subcellular Location
Mitochondrion
Protein Families
Bacterial ribosomal protein bL12 family
Amount: 50ug
Available: In stock
Listprice: €350.03
Price: €350.03
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close