Comparison

Recombinant Human 39S ribosomal protein L42, mitochondrial(MRPL42)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP014852HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q9Y6G3
Gene Names
MRPL42
Organism
Homo sapiens (Human)
AA Sequence
KSTYSPLPDDYNCNVELALTSDGRTIVCYHPSVDI PYEHTKPIPRPDPVHNNEETHDQVLKTRLEEKVEH LEEGPMIEQLSKMFFTTKHRWYPHGRYHRCRKNLN PPKDR
Expression Region
33-142aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
40.1 kDa
Alternative Name
28S ribosomal protein S32, mitochondrial . MRP-S32 . S32mt39S ribosomal protein L31, mitochondrial . L31mt . MRP-L31
Reference
Mao Y.F., Peng Y., Dai M., Huang Q.H., Song H., Zhang Q.H., Mao M., Fu G., Luo M., Chen J.H., Hu R. Isolating a new human cDNA.Chen J.H., Luo W.Q., Hu S.N., Li G.T., Jin J., Huang X.W., Zhou H.J., Yuan J.G., Qiang B.Q.Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. , Gu J., Chen S.-J., Chen Z.Genome Res. 10:1546-1560(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Subcellular Location
Mitochondrion
Protein Families
Mitochondrion-specific ribosomal protein mL42 family
Amount: 10ug
Available: In stock
Listprice: €175.45
Price: €175.45
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close