Comparison

Recombinant Human 39S ribosomal protein L54, mitochondrial(MRPL54)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP014871HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
GWGAWELLNPATSGRLLARDYAKKPVMKGAKSGKG AVTSEALKDPDVCTDPVQLTTYAMGVNIYKEGQDV PLKPDAEYPEWLFEMNLGPPKTLEELDPESREYWR RLRKQNIWRHNRLSKNKRL
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
Q6P161
Gene Names
MRPL54
Tag Info
N-terminal 6xHis-tagged
Expression Region
15-138aa
MW of Fusion Proten
18, 2
Sequence Info
Full Length
Reference
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close