Comparison

Recombinant Human 28S ribosomal protein S22, mitochondrial(MRPS22)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP014908HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P82650
Gene Names
MRPS22
Organism
Homo sapiens (Human)
AA Sequence
MAPLGTTVLLWSLLRSSPGVERVCFRARIQPWHGG LLQPLPCSFEMGLPRRRFSSEAAESGSPETKKPTF MDEEVQSILTKMTGLNLQKTFKPAIQELKPPTYKL MTQAQLEEATRQAVEAAKVRLKMPPVLEERVPIND VLAEDKILEGTETTKYVFTDISYSIPHRERFIVVR EPSGTLRKASWEERDRMIQVYFPKEGRKILTPIIF KEENLRTMYSQDRHVDVLNLCFAQFEPDSTEYIKV HHKTYEDIDKRGKYDLLRSTRYFGGMVWYFVNNKK IDGLLIDQIQRDLIDDATNLVQLYHVLHPDGQSAQ GAKDQAAEGINLIKVFAKTEAQKGAYIELTLQTYQ EALSRHSAAS
Expression Region
1-360aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
68.3 kDa
Reference
"A proteomics approach to the identification of mammalian mitochondrial small subunit ribosomal proteins."
Koc E.C., Burkhart W., Blackburn K., Moseley A., Koc H., Spremulli L.L.
J. Biol. Chem. 275:32585-32591(2000)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Involvement in disease
Combined oxidative phosphorylation deficiency 5 (COXPD5)
Subcellular Location
Mitochondrion
Protein Families
Mitochondrion-specific ribosomal protein mS22 family
Amount: 100ug
Available: In stock
Listprice: €560.05
Price: €560.05
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close