Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Amount |
100ug |
Host |
E.coli |
Item no. |
CSB-EP015007MO(F1)-100 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Others |
Uniprot ID |
P19437 |
Gene Names |
Ms4a1 |
Organism |
Mus musculus (Mouse) |
AA Sequence |
ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNS SEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLV TAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKM KEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEI NFPAPPQEQESLPVENEIAP |
Expression Region |
132-291aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
34.1 kDa |
Alternative Name(s) |
B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20 |
Relevance |
This protein may be involved in the regulation of B-cell activation and proliferation. |
Reference |
CD20 deficiency in humans results in impaired T cell-independent antibody responses.Kuijpers T.W., Bende R.J., Baars P.A., Grummels A., Derks I.A.M., Dolman K.M., Beaumont T., Tedder T.F., van Noesel C.J.M., Eldering E., van Lier R.A.W.J. Clin. Invest. 120:214-222(2010) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
This protein may be involved in the regulation of B-cell activation and proliferation. |
Subcellular Location |
Cell membrane, Multi-pass membrane protein, Cell membrane, Lipid-anchor |
Protein Families |
MS4A family |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.