Comparison

Recombinant Mouse B-lymphocyte antigen CD20(Ms4a1) ,partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015007MO(F1)-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
B-cell differentiation antigen Ly-44Lymphocyte antigen 44Membrane-spanning 4-domains subfamily A member 1; CD20
AA Sequence
ILNMTLSHFLKMRRLELIQTSKPYVDIYDCEPSNS SEKNSPSTQYCNSIQSVFLGILSAMLISAFFQKLV TAGIVENEWKRMCTRSKSNVVLLSAGEKNEQTIKM KEEIIELSGVSSQPKNEEEIEIIPVQEEEEEEAEI NFPAPPQEQESLPVENEIAP
Research Topic
Others
Uniprot ID
P19437
Gene Names
Ms4a1
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
132-291aa
MW of Fusion Proten
34, 1
Sequence Info
Partial
Relevance
This protein may be involved in the regulation of B-cell activation and proliferation.
Reference
CD20 deficiency in humans results in impaired T cell-independent antibody responses.Kuijpers T.W., Bende R.J., Baars P.A., Grummels A., Derks I.A.M., Dolman K.M., Beaumont T., Tedder T.F., van Noesel C.J.M., Eldering E., van Lier R.A.W.J. Clin. Invest. 120:214-222(2010)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 100ug
Available: In stock
Listprice: €495.78
Price: €495.78
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close