Comparison

Recombinant Human DNA mismatch repair protein Msh6(MSH6),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP015032HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
G/T mismatch-binding protein ; GTBP ; GTMBPMutS-alpha 160 kDa subunit ; p160
AA Sequence
MSRQSTLYSFFPKSPALSDANKASARASREGGRAA AAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAK NLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPW WPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTR GWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRA MQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEV GTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQI KKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISS GVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSS RKETPSATKQATSISSETKNTLRAFSAPQNSESQA HVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRR PDHPDFDASTLYVPE
Research Topic
Epigenetics and Nuclear Signaling
Uniprot ID
P52701
Gene Names
MSH6
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-400aa
MW of Fusion Proten
60, 1
Sequence Info
Partial
Relevance
Component of the post-replicative DNA mismatch repair syst (MMR). Heterodimerizes with MSH2 to form MutS alpha, which binds to DNA mismatches thereby initiating DNA repair. When bound, MutS alpha bends the DNA helix and shields approximately 20 base pairs, and recognizes single base mismatches and dinucleotide insertion-deletion loops (IDL) in the DNA. After mismatch binding, forms a ternary complex with the MutL alpha heterodimer, which is thought to be responsible for directing the downstream MMR events, including strand discrimination, excision, and resynthesis. ATP binding and hydrolysis play a pivotal role in mismatch repair functions. The ATPase activity associated with MutS alpha regulates binding similar to a molecular switch: mismatched DNA provokes ADP-->ATP exchange, resulting in a discernible conformational transition that converts MutS alpha into a sliding clamp capable of hydrolysis-independent diffusion along the DNA backbone. This transition is crucial for mismatch repair. MutS alpha may also play a role in DNA homologous recombination repair. Recruited on chromatin in G1 and early S phase via its PWWP domain that specifically binds trimethylated 'Lys-36' of histone H3 (H3K36me3): early recruitment to chromatin to be replicated allowing a quick identification of mismatch repair to initiate the DNA mismatch repair reaction
Reference
The histone mark H3K36me3 regulates human DNA mismatch repair through its interaction with MutSalpha.Li F., Mao G., Tong D., Huang J., Gu L., Yang W., Li G.M.Cell 153:590-600(2013)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close