Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP015032HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
P52701 |
Gene Names |
MSH6 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSRQSTLYSFFPKSPALSDANKASARASREGGRAA AAPGASPSPGGDAAWSEAGPGPRPLARSASPPKAK NLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPW WPCLVYNHPFDGTFIREKGKSVRVHVQFFDDSPTR GWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRA MQRADEALNKDKIKRLELAVCDEPSEPEEEEEMEV GTTYVTDKSEEDNEIESEEEVQPKTQGSRRSSRQI KKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISS GVGDSESEGLNSPVKVARKRKRMVTGNGSLKRKSS RKETPSATKQATSISSETKNTLRAFSAPQNSESQA HVSGGGDDSSRPTVWYHETLEWLKEEKRRDEHRRR PDHPDFDASTLYVPE |
Expression Region |
1-400aa |
Sequence Info |
Partial |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
60.1 kDa |
Alternative Name(s) |
G/T mismatch-binding protein ; GTBP ; GTMBPMutS-alpha 160KDA subunit ; p160 |
Relevance |
Component of the post-replicative DNA mismatch repair syst (MMR). Heterodimerizes with MSH2 to form MutS alpha, which binds to DNA mismatches thereby initiating DNA repair. When bound, MutS alpha bends the DNA helix and shields approximately 20 base pairs, and recognizes single base mismatches and dinucleotide insertion-deletion loops (IDL) in the DNA. After mismatch binding, forms a ternary complex with the MutL alpha heterodimer, which is thought to be responsible for directing the downstream MMR events, including strand discrimination, excision, and resynthesis. ATP binding and hydrolysis play a pivotal role in mismatch repair functions. The ATPase activity associated with MutS alpha regulates binding similar to a molecular switch: mismatched DNA provokes ADP-->ATP exchange, resulting in a discernible conformational transition that converts MutS alpha into a sliding clamp capable of hydrolysis-independent diffusion along the DNA backbone. This transition is crucial for mismatch repair. MutS alpha may also play a role in DNA homologous recombination repair. Recruited on chromatin in G1 and early S phase via its PWWP domain that specifically binds trimethylated 'Lys-36' of histone H3 (H3K36me3): early recruitment to chromatin to be replicated allowing a quick identification of mismatch repair to initiate the DNA mismatch repair reaction |
Reference |
The histone mark H3K36me3 regulates human DNA mismatch repair through its interaction with MutSalpha.Li F., Mao G., Tong D., Huang J., Gu L., Yang W., Li G.M.Cell 153:590-600(2013) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Component of the post-replicative DNA mismatch repair system (MMR). Heterodimerizes with MSH2 to form MutS alpha, which binds to DNA mismatches thereby initiating DNA repair. When bound, MutS alpha bends the DNA helix and shields approximately 20 base pairs, and recognizes single base mismatches and dinucleotide insertion-deletion loops (IDL) in the DNA. After mismatch binding, forms a ternary complex with the MutL alpha heterodimer, which is thought to be responsible for directing the downstream MMR events, including strand discrimination, excision, and resynthesis. ATP binding and hydrolysis play a pivotal role in mismatch repair functions. The ATPase activity associated with MutS alpha regulates binding similar to a molecular switch |
Involvement in disease |
Hereditary non-polyposis colorectal cancer 5 (HNPCC5); Endometrial cancer (ENDMC); Mismatch repair cancer syndrome (MMRCS); Colorectal cancer (CRC) |
Subcellular Location |
Nucleus, Chromosome |
Protein Families |
DNA mismatch repair MutS family |
Paythway |
DNArepairpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.