Comparison

Recombinant Mouse Mesothelin(Msln)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP015044MO-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Others
Uniprot ID
Q61468
Gene Names
Msln
Organism
Mus musculus (Mouse)
AA Sequence
DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGT MLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYP ESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLK VSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGD IPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQ RHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASV KDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQ KLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLG LGLQGGIPNGYLVLDFNVREAFS
Expression Region
298-600aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
50.1 kDa
Alternative Name
Pre-pro-megakaryocyte-potentiating factor
Relevance
Mbrane-anchored forms may play a role in cellular adhesion.
Reference
Binding of ovarian cancer antigen CA125/MUC16 to mesothelin mediates cell adhesion.Rump A., Morikawa Y., Tanaka M., Minami S., Umesaki N., Takeuchi M., Miyajima A.J. Biol. Chem. 279:9190-9198(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Membrane-anchored forms may play a role in cellular adhesion.
Subcellular Location
Cell membrane, Lipid-anchor, GPI-anchor, Golgi apparatus, SUBCELLULAR LOCATION: Megakaryocyte-potentiating factor: Secreted
Protein Families
Mesothelin family
Tissue Specificity
Highly expressed in lung and heart. Expressed at low levels in spleen, liver, kidney and testis. Present in lung (at protein level).
Amount: 10ug
Available: In stock
Listprice: €230.66
Price: €230.66
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close