Comparison

Recombinant Mouse Mesothelin(Msln)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP015044MO-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Pre-pro-megakaryocyte-potentiating factor
AA Sequence
DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGT MLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYP ESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLK VSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGD IPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQ RHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASV KDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQ KLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLG LGLQGGIPNGYLVLDFNVREAFS
Research Topic
Others
Uniprot ID
Q61468
Gene Names
Msln
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
298-600aa
MW of Fusion Proten
50, 1
Sequence Info
Full Length
Relevance
Mbrane-anchored forms may play a role in cellular adhesion.
Reference
Binding of ovarian cancer antigen CA125/MUC16 to mesothelin mediates cell adhesion.Rump A., Morikawa Y., Tanaka M., Minami S., Umesaki N., Takeuchi M., Miyajima A.J. Biol. Chem. 279:9190-9198(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Mus musculus (Mouse)
Amount: 10ug
Available: In stock
Listprice: €204.88
Price: €204.88
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close