« Back
Home /
Recombinant Mouse Mesothelin(Msln),partial

Recombinant Mouse Mesothelin(Msln),partial

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer Hepatic Cancer Uterine, Ovarian & Cervical Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP015044MO-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Others
Uniprot ID	Q61468
Gene Names	Msln
Organism	Mus musculus (Mouse)
AA Sequence	DAEQKACPPGKEPYKVDEDLIFYQNWELEACVDGT MLARQMDLVNEIPFTYEQLSIFKHKLDKTYPQGYP ESLIQQLGHFFRYVSPEDIHQWNVTSPDTVKTLLK VSKGQKMNAQAIALVACYLRGGGQLDEDMVKALGD IPLSYLCDFSPQDLHSVPSSVMWLVGPQDLDKCSQ RHLGLLYQKACSAFQNVSGLEYFEKIKTFLGGASV KDLRALSQHNVSMDIATFKRLQVDSLVGLSVAEVQ KLLGPNIVDLKTEEDKSPVRDWLFRQHQKDLDRLG LGLQGGIPNGYLVLDFNVREAFS
Expression Region	298-600aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	50.1 kDa
Alternative Name(s)	Pre-pro-megakaryocyte-potentiating factor
Relevance	Mbrane-anchored forms may play a role in cellular adhesion.
Reference	Binding of ovarian cancer antigen CA125/MUC16 to mesothelin mediates cell adhesion.Rump A., Morikawa Y., Tanaka M., Minami S., Umesaki N., Takeuchi M., Miyajima A.J. Biol. Chem. 279:9190-9198(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Membrane-anchored forms may play a role in cellular adhesion.
Subcellular Location	Cell membrane, Lipid-anchor, GPI-anchor, Golgi apparatus, SUBCELLULAR LOCATION: Megakaryocyte-potentiating factor: Secreted
Protein Families	Mesothelin family
Tissue Specificity	Highly expressed in lung and heart. Expressed at low levels in spleen, liver, kidney and testis. Present in lung (at protein level).
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time