Comparison

Recombinant Human 5-formyltetrahydrofolate cyclo-ligase(MTHFS)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
Item no. CSB-EP015159HU-10
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P49914
Gene Names
MTHFS
Organism
Homo sapiens (Human)
AA Sequence
AAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVL SQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDI FQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPK TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDK HGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFK EQICLQVPVNENDMKVDEVLYEDSSTA
Expression Region
2-203aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-SUMO-tagged
MW
39.1 kDa
Alternative Name
5, 10-methenyl-tetrahydrofolate synthetase . MTHFS . Methenyl-THF synthetase
Relevance
Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5, 10-methenyltetrahydrofolate.
Reference
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5, 10-methenyltetrahydrofolate.
Subcellular Location
Cytoplasm
Protein Families
5-formyltetrahydrofolate cyclo-ligase family
Amount: 10ug
Available: In stock
Listprice: €175.45
Price: €175.45
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close