« Back
Home /
Recombinant Human 5-formyltetrahydrofolate cyclo-ligase(MTHFS)

Recombinant Human 5-formyltetrahydrofolate cyclo-ligase(MTHFS)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP015159HU-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Metabolism
Uniprot ID	P49914
Gene Names	MTHFS
Organism	Homo sapiens (Human)
AA Sequence	AAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVL SQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDI FQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPK TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDK HGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFK EQICLQVPVNENDMKVDEVLYEDSSTA
Expression Region	2-203aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-SUMO-tagged
MW	39.1 kDa
Alternative Name(s)	5, 10-methenyl-tetrahydrofolate synthetase ; MTHFS ; Methenyl-THF synthetase
Relevance	Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5, 10-methenyltetrahydrofolate.
Reference	An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5, 10-methenyltetrahydrofolate.
Subcellular Location	Cytoplasm
Protein Families	5-formyltetrahydrofolate cyclo-ligase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time