Comparison

Recombinant Human 5-formyltetrahydrofolate cyclo-ligase(MTHFS)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015159HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
5, 10-methenyl-tetrahydrofolate synthetase ; MTHFS ; Methenyl-THF synthetase
AA Sequence
AAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVL SQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDI FQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPK TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDK HGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFK EQICLQVPVNENDMKVDEVLYEDSSTA
Research Topic
Metabolism
Uniprot ID
P49914
Gene Names
MTHFS
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
2-203aa
MW of Fusion Proten
39, 1
Sequence Info
Full Length
Relevance
Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5, 10-methenyltetrahydrofolate.
Reference
An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close