Comparison

Recombinant Human Mucin-2(MUC2),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015222HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Intestinal mucin-2
AA Sequence
VCSTWGNFHYKTFDGDVFRFPGLCDYNFASDCRGS YKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYL TRHLAVLNGAVVSTPHYSPGLLIEKSDAYTKVYSR AGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGL QSYSEFLSDGVLFSPLEFGNMQKINQPDVVCEDPE EEVAPASCSEHRAECERLLTAEAFADCQDL
Research Topic
Signal Transduction
Uniprot ID
Q02817
Gene Names
MUC2
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
36-240aa
MW of Fusion Proten
38, 8
Sequence Info
partial
Relevance
Coats the epithelia of the intestines, airways, and other mucus mbrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Reference
A quantitative atlas of mitotic phosphorylation.Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close