Comparison

Recombinant Mouse Methylmalonyl-CoA mutase, mitochondrial(Mutc)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP015243MO-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
P16332
Gene Names
Mut
Organism
Mus musculus (Mouse)
AA Sequence
LHQQQPLHPEWAVLAKKQLKGKNPEDLIWHTPEGI SIKPLYSRADTLDLPEELPGVKPFTRGPYPTMYTY RPWTIRQYAGFSTVEESNKFYKDNIKAGQQGLSVA FDLATHRGYDSDNPRVRGDVGMAGVAIDTVEDTKI LFDGIPLEKMSVSMTMNGAVIPVLATFIVTGEEQG VPKEKLTGTIQNDILKEFMVRNTYIFPPEPSMKII ADIFQYTAQHMPKFNSISISGYHMQEAGADAILEL AYTIADGLEYCRTGLQAGLTIDEFAPRLSFFWGIG MNFYMEIAKMRAGRRLWAHLIEKMFQPKNSKSLLL RAHCQTSGWSLTEQDPYNNIVRTAIEAMAAVFGGT QSLHTNSFDEALGLPTVKSARIARNTQIIIQEESG IPKVADPWGGSYMMESLTNDVYEAALKLIYEVEEM GGMAKAVAEGIPKLRIEECAARRQARIDSGSEVIV GVNKYQLEKEDSVEVLAIDNTSVRKKQIEKLKKIK SSRDQALAEQCLSALTQCAASGDGNILALAVDAAR ARCTVGEITDALKKVFGEHKANDRMVSGAYRQEFG ESKEITSAIKRVNKFMEREGRRPRLLVAKMGQDGH DRGAKVIATGFADLGFDVDIGPLFQTPREVAQQAV DADVHAVGVSTLAAGHKTLVPELIKELTALGRPDI LVMCGGVIPPQDYEFLYEVGVSNVFGPGTRIPRAA VQVLDDIEKCLAEKQQSV
Expression Region
31-748aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
83.2 kDa
Alternative Name
Methylmalonyl-CoA isomerase
Relevance
Involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle.
Reference
"Primary structure and activity of mouse methylmalonyl-CoA mutase."Wilkemeyer M.F., Crane A.M., Ledley F.D.Biochem. J. 271:449-455(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Involved in the degradation of several amino acids, odd-chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle.
Subcellular Location
Mitochondrion matrix
Protein Families
Methylmalonyl-CoA mutase family
Amount: 50ug
Available: In stock
Listprice: €426.10
Price: €426.10
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close