Recombinant Human Myosin light chain 1/3, skeletal muscle isoform(MYL1)

Manufacturer Cusabio
Category
Type Proteins
Specific against Human
Amount 10ug
Host E.coli
Item no. CSB-EP015305HU-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P05976
Gene Names
MYL1
Organism
Homo sapiens (Human)
AA Sequence
MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVL RALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFL PMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMG AELRHVLATLGEKMKEEEVEALMAGQEDSNGCINY EAFVKHIMSI
Expression Region
1-150aa
Sequence Info
Full Length of Isoform MLC3
Tag Info
N-terminal GST-tagged
MW
43.7 kDa
Alternative Name(s)
Myosin light chain alkali 1/2
Relevance
Regulatory light chain of myosin. Does not bind calcium.
Reference
"Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms."
Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H.
Gene 66:135-146(1988)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €154.00
Price: €154.00
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

 
Close