Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP015305HU-10 |
Conjugate/Tag |
GST |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Signal Transduction |
Uniprot ID |
P05976 |
Gene Names |
MYL1 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVL RALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFL PMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMG AELRHVLATLGEKMKEEEVEALMAGQEDSNGCINY EAFVKHIMSI |
Expression Region |
1-150aa |
Sequence Info |
Full Length of Isoform MLC3 |
Source |
E.coli |
Tag Info |
N-terminal GST-tagged |
MW |
43.7 kDa |
Alternative Name(s) |
Myosin light chain alkali 1/2 |
Relevance |
Regulatory light chain of myosin. Does not bind calcium. |
Reference |
"Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms." Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H. Gene 66:135-146(1988) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Regulatory light chain of myosin. Does not bind calcium. |
Tag Information |
N-terminal GST-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.