Comparison

Recombinant Human Myosin light chain 1/3, skeletal muscle isoform(MYL1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015305HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Myosin light chain alkali 1/2
AA Sequence
MSFSADQIAEFKEAFLLFDRTGDSKITLSQVGDVL RALGTNPTNAEVRKVLGNPSNEELNAKKIEFEQFL PMMQAISNNKDQATYEDFVEGLRVFDKEGNGTVMG AELRHVLATLGEKMKEEEVEALMAGQEDSNGCINY EAFVKHIMSI
Research Topic
Signal Transduction
Uniprot ID
P05976
Gene Names
MYL1
Tag Info
N-terminal GST-tagged
Expression Region
1-150aa
MW of Fusion Proten
43, 7
Sequence Info
Full Length of Isoform MLC3
Relevance
Regulatory light chain of myosin. Does not bind calcium.
Reference
"Alkali myosin light chains in man are encoded by a multigene family that includes the adult skeletal muscle, the embryonic or atrial, and nonsarcomeric isoforms."
Seidel U., Bober E., Winter B., Lenz S., Lohse P., Goedde H., Grzeschik K., Arnold H.H.
Gene 66:135-146(1988)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close