Comparison

Recombinant Human Myosin light chain 3(MYL3)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP015310HU-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P08590
Gene Names
MYL3
Organism
Homo sapiens (Human)
AA Sequence
MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEV EFDASKIKIEFTPEQIEEFKEAFMLFDRTPKCEMK ITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELN TKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVF DKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAG QEDSNGCINYEAFVKHIMSS
Expression Region
1-195aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
48.8 kDa
Alternative Name
Cardiac myosin light chain 1
Relevance
Regulatory light chain of myosin. Does not bind calcium.
Reference
"Human ventricular/slow twitch myosin alkali light chain gene characterization, sequence, and chromosomal location."
Fodor W.L., Darras B., Seharaseyon J., Falkenthal S., Francke U., Vanin E.F.
J. Biol. Chem. 264:2143-2149(1989)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Regulatory light chain of myosin. Does not bind calcium.
Involvement in disease
Cardiomyopathy, familial hypertrophic 8 (CMH8)
Paythway
Cardiacmusclecontraction
Amount: 50ug
Available: In stock
Listprice: €350.03
Price: €350.03
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close