Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP015437HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Epigenetics and Nuclear Signaling |
Uniprot ID |
P60321 |
Gene Names |
NANOS2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MQLPPFDMWKDYFNLSQVVWALIASRGQRLETQEI EEPSPGPPLGQDQGLGAPGANGGLGTLCNFCKHNG ESRHVYSSHQLKTPDGVVVCPILRHYVCPVCGATG DQAHTLKYCPLNGGQQSLYRRSGRNSAGRRVKR |
Expression Region |
1-138aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
31.1 kDa |
Relevance |
Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the fale fate. Represses the fale fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for preiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial st cell population. Not essential for the assbly of P-bodies but is required for the maintenance of their normal state . |
Reference |
NANOS3 function in human germ cell development.Julaton V.T., Reijo Pera R.A.Hum. Mol. Genet. 20:2238-2250(2011) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Plays a key role in the sexual differentiation of germ cells by promoting the male fate but suppressing the female fate. Represses the female fate pathways by suppressing meiosis, which in turn results in the promotion of the male fate. Maintains the suppression of meiosis by preventing STRA8 expression, which is required for premeiotic DNA replication, after CYP26B1 is decreased. Regulates the localization of the CCR4-NOT deadenylation complex to P-bodies and plays a role in recruiting the complex to trigger the degradation of mRNAs involved in meiosis. Required for the maintenance of the spermatogonial stem cell population. Not essential for the assembly of P-bodies but is required for the maintenance of their normal state (By similarity). |
Subcellular Location |
Cytoplasm, Cytoplasm, P-body, Cytoplasm, perinuclear region |
Protein Families |
Nanos family |
Tissue Specificity |
Testis and ovary. Expression found in several spermatogenic stages: in cells on the periphery of the tubules which could correspond to spermatogonia, in spermatocytes and in round spermatids (at protein level). |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.