« Back
Home /
Recombinant Human Nicotinate phosphoribosyltransferase(NAPRT),partial

Recombinant Human Nicotinate phosphoribosyltransferase(NAPRT),partial

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	E.coli
Item no.	CSB-EP015451HU-10
Conjugate/Tag	GST
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Metabolism
Uniprot ID	Q6XQN6
Gene Names	NAPRT1
Organism	Homo sapiens (Human)
AA Sequence	MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQE PHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLP NFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRK VFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQ EGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQ PRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDML QLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPL LRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEH RRLRSPAQYQVVLSERLQALVNSLCAGQSP
Expression Region	229-538aa
Sequence Info	Partial
Source	E.coli
Tag Info	N-terminal GST-tagged
MW	60.2 kDa
Alternative Name(s)	FHA-HIT-interacting proteinNicotinate phosphoribosyltransferase domain-containing protein 1
Relevance	Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.
Reference	Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.
Subcellular Location	Cytoplasm, cytosol
Protein Families	NAPRTase family
Tag Information	N-terminal GST-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP015451HU-10-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time