Comparison

Recombinant Human Nicotinate phosphoribosyltransferase(NAPRT1)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015451HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Metabolism
Uniprot ID
Q6XQN6
Gene Names
NAPRT1
Organism
Homo sapiens (Human)
AA Sequence
MLAPAAGEGPGVDLAAKAQVWLEQVCAHLGLGVQE PHPGERAAFVAYALAFPRAFQGLLDTYSVWRSGLP NFLAVALALGELGYRAVGVRLDSGDLLQQAQEIRK VFRAAAAQFQVPWLESVLIVVSNNIDEEALARLAQ EGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQ PRMKLTEDPEKQTLPGSKAAFRLLGSDGSPLMDML QLAEEPVPQAGQELRVWPPGAQEPCTVRPAQVEPL LRLCLQQGQLCEPLPSLAESRALAQLSLSRLSPEH RRLRSPAQYQVVLSERLQALVNSLCAGQSP
Expression Region
229-538aa
Sequence Info
Partial
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
60.2 kDa
Alternative Name
FHA-HIT-interacting proteinNicotinate phosphoribosyltransferase domain-containing protein 1
Relevance
Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.
Reference
Initial characterization of the human central proteome.Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.BMC Syst. Biol. 5:17-17(2011)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Catalyzes the conversion of nicotinic acid (NA) to NA mononucleotide (NaMN). Essential for NA to increase cellular NAD levels and prevent oxidative stress of the cells.
Subcellular Location
Cytoplasm, cytosol
Protein Families
NAPRTase family
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close