Comparison

Recombinant Human Napsin-A(NAPSA)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015452HU-100
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Cell Biology
Uniprot ID
O96009
Gene Names
NAPSA
Organism
Homo sapiens (Human)
AA Sequence
KPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTG SSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQAN GTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFG EALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPM DVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGS DPAHYIPPLTFVPVTVPAYWQIHMERVKVGPGLTL CAKGCAAILDTGTSLITGPTEEIRALHAAIGGIPL LAGEYIILCSEIPKLPAVSFLLGGVWFNLTAHDYV IQTTRNGVRLCLSGFQALDVPPPAGPFWILGDVFL GTYVAVFDRGDMKSSARVGLARARTRGADLGWGET AQAQFPG
Expression Region
64-420aa
Sequence Info
Full Length of Mature Protein
Source
E.coli
Tag Info
N-terminal 6xHis-tagged
MW
42.5 kDa
Alternative Name
Aspartyl protease 4 . ASP4 . Asp 4Napsin-1TA01/TA02
Relevance
May be involved in processing of pneumocyte surfactant precursors.
Reference
Membrane-anchored aspartyl protease with Alzheimer's disease beta-secretase activity.Yan R., Bienkowski M.J., Shuck M.E., Miao H., Tory M.C., Pauley A.M., Brashier J.R., Stratman N.C., Mathews W.R., Buhl A.E., Carter D.B., Tomasselli A.G., Parodi L.A., Heinrikson R.L., Gurney M.E.Nature 402:533-537(1999)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
May be involved in processing of pneumocyte surfactant precursors.
Subcellular Location
Secreted
Protein Families
Peptidase A1 family
Tissue Specificity
Expressed predominantly in adult lung (type II pneumocytes) and kidney and in fetal lung. Low levels in adult spleen and very low levels in peripheral blood leukocytes.
Amount: 100ug
Available: In stock
Listprice: €405.35
Price: €405.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close