Comparison

Recombinant Human Arylamine N-acetyltransferase 2(NAT2)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP015471HU-50
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Arylamide acetylase 2
N-acetyltransferase type 2
Short name:
NAT-2
Polymorphic arylamine N-acetyltransferase
Short name:
PNAT
AA Sequence
MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAV PFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQ VNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGM VHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISG KDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEF LNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQ TSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFN YKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLV PKPGDGSLTI
Research Topic
Signal Transduction
Uniprot ID
P11245
Gene Names
NAT2
Tag Info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-290aa
MW of Fusion Proten
49, 5
Sequence Info
Full Length
Relevance
Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
Reference
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 50ug
Available: In stock
Listprice: €310.35
Price: €310.35
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close