« Back
Home /
Recombinant Human Arylamine N-acetyltransferase 2(NAT2)

Recombinant Human Arylamine N-acetyltransferase 2(NAT2)

Manufacturer	Cusabio
Category	Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	50ug
Host	E.coli
Item no.	CSB-EP015471HU-50
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research areas	Signal Transduction
Target / Protein	NAT2
Biologically active	Not Test
Expression system	E.coli
Species of origin	Homo sapiens (Human)
Uniprot ID	P11245
AA Sequence	MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAV PFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQ VNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGM VHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISG KDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEF LNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQ TSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFN YKDNTDLVEFKTLTEEEVEEVLKNIFKISLGRNLV PKPGDGSLTI
Tag Info	N-terminal 6xHis-SUMO-tagged
Expression Region	1-290aa
Protein length	Full Length
MW	49.5 kDa
Alternative Name(s)	Arylamide acetylase 2 N-acetyltransferase type 2 Short name: NAT-2 Polymorphic arylamine N-acetyltransferase Short name: PNAT
Relevance	Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
References	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens.
Subcellular Location	Cytoplasm
Protein Families	Arylamine N-acetyltransferase family
Tag Information	N-terminal 6xHis-SUMO-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

CSB-EP015471HU-50-datasheet.pdf

Request safety datasheet

Simple Order Order Subscription

Amount: 50ug

available

Request delivery time