Comparison

Recombinant Rat Neural cell adhesion molecule 1(Ncam1),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 50ug
Host E.coli
Item no. CSB-EP015511RA-50
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Neuroscience
Uniprot ID
P13596
Gene Names
Ncam1
Organism
Rattus norvegicus (Rat)
AA Sequence
LQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISW FSPNGEKLSPNQQRISVVWNDDDSSTLTIYNANID DAGIYKCVVTAEDGTQSEATVNVKIFQKLMFKNAP TPQEFKEGEDAVIVCDVVSSLPPTIIWKHKGRDVI LKKDVRFIVLSNNYLQIRGIKKTDEGTYRCEGRIL ARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQ SVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKH IFSDDSSELTIRNVDKNDEAEYVCIAENKAGEQDA SIHLKVFAKPKITYVENQTAMELEEQVTLTCEASG DPIPSITWRTSTRNISSEEKASWTRPEKQETLDGH MVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQ DSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEV FAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASY LEVTPDSENDFGNYNCTAVNRIGQESLEFILVQAD TPSSPSIDRVEPYSSTAQVQFDEPEATGGVPILKY KAEWKSLGEEAWHSKWYDAKEANMEGIVTIMGLKP ETRYAVRLAALNGKGLGEISAATEFKTQPVREPSA PKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVKY RALASEWKPEIRLPSGSDHVMLKSLDWNAEYEVYV VAENQQGKSKAAHFVFRTSAQPTAIPANGSPTAGL ST
Expression Region
20-721aa
Sequence Info
Extracellular Domain
Source
E.coli
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW
82.7 kDa
Alternative Name
CD_antigen: CD56
Relevance
This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.
Reference
"Expression of the unique NCAM VASE exon is independently regulated in distinct tissues during development."
Small S.J., Akeson R.
J. Cell Biol. 111:2089-2096(1990)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
This protein is a cell adhesion molecule involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc.
Subcellular Location
Cell membrane, Single-pass type I membrane protein
Amount: 50ug
Available: In stock
Listprice: €350.03
Price: €350.03
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close