Manufacturer |
Cusabio
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Amount |
10ug |
Host |
E.coli |
Item no. |
CSB-EP015531HU-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Available |
|
Research Topic |
Transcription |
Uniprot ID |
O43639 |
Gene Names |
NCK2 |
Organism |
Homo sapiens (Human) |
AA Sequence |
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDS KTWWRVRNAANRTGYVPSNYVERKNSLKKGSLVKN LKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSG ADRIYDLNIPAFVKFAYVAEREDELSLVKGSRVTV MEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAE SPSFLSLRKGASLSNGQGSRVLHVVQTLYPFSSVT EEELNFEKGETMEVIEKPENDPEWWKCKNARGQVG LVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRF AGREWYYGNVTRHQAECALNERGVEGDFLIRDSES SPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFH TMDELVEHYKKAPIFTSEHGEKLYLVRALQ |
Expression Region |
1-380aa |
Sequence Info |
Full Length |
Source |
E.coli |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
MW |
58.9 kDa |
Alternative Name(s) |
Growth factor receptor-bound protein 4NCK adaptor protein 2 ; Nck-2SH2/SH3 adaptor protein NCK-beta |
Relevance |
Adapter protein which associates with tyrosine-phosphorylated growth factor receptors or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role in ELK1-dependent transcriptional activation in response to activated Ras signaling. |
Reference |
Identification of Nck family genes, chromosomal localization, expression, and signaling specificity.Chen M., She H., Davis E.M., Spicer C.M., Kim L., Ren R., LeBeau M.M., Li W.J. Biol. Chem. 273:25171-25178(1998) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Adapter protein which associates with tyrosine-phosphorylated growth factor receptors or their cellular substrates. Maintains low levels of EIF2S1 phosphorylation by promoting its dephosphorylation by PP1. Plays a role in ELK1-dependent transcriptional activation in response to activated Ras signaling. |
Subcellular Location |
Cytoplasm, Endoplasmic reticulum |
Tissue Specificity |
Ubiquitous. |
Paythway |
ErbBsignalingpathway |
Tag Information |
N-terminal 6xHis-SUMO-tagged |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.