Recombinant Escherichia coli Acyl carrier protein(acpP)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 10ug
Host E.coli
ArtNr CSB-EP015636ENV-10
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Research areas
others
Target / Protein
acpP
Biologically active
Not Test
Species of origin
Escherichia coli (strain K12?
Uniprot ID
P0A6A8
AA Sequence
MSTIEERVKKIIGEQLGVKQEEVTNNASFVEDLGA DSLDTVELVMALEEEFDTEIPDEEAEKITTVQAAI DYINGHQA
Tag info
N-terminal 6xHis-SUMO-tagged
Expression Region
1-78aa
Protein length
Full Length
MW
24.6 kDa
Alternative Name(s)
Cytosolic-activating factor
Relevance
Carrier of the growing fatty acid chain in fatty acid biosynthesis.
Reference
"Altered molecular form of acyl carrier protein associated with beta-ketoacyl-acyl carrier protein synthase II (fabF) mutants."
Jackowski S., Rock C.O.
J. Bacteriol. 169:1469-1473(1987)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Amount: 10ug
Available: In stock
Listprice: €224.38
Price: €224.38
lieferbar

Get an offer

Questions about this Product?

Your Contact Person:

Arne Pelz

sales@hoelzel.de

Close