Comparison

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10(NDUFB10)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 1mg
Host E.coli
Item no. CSB-EP015642HU-1
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
Complex I-PDSW
AA Sequence
MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIV DRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITE CKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLK ACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL GAYSSARKCLAKQRQRMLQERKAAKEAAAATS
Research Topic
others
Uniprot ID
O96000
Gene Names
NDUFB10
Tag Info
N-terminal GST-tagged
Expression Region
1-172aa
MW of Fusion Proten
47, 8
Sequence Info
Full Length
Relevance
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Reference
"One subunit of human NADH-ubiquinone oxidoreductase, hPDSW, located at 16p13.3 and down-regulated in a prostate cell line."
Wang L., Zhang J., Smith D.I.
Submitted (AUG-1998)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 1mg
Available: In stock
Listprice: €1,371.07
Price: €1,371.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close