Comparison

Recombinant Human Neurofilament light polypeptide(NEFL)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Format Lyophilized Powder
Amount 200ug
Host E.coli
Item no. CSB-EP015688HU-200
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
Alternative Name(s)
68 kDa neurofilament protein
Neurofilament triplet L protein
AA Sequence
SSFSYEPYYSTSYKRRYVETPRVHISSVRSGYSTA RSAYSSYSAPVSSSLSVRRSYSSSSGSLMPSLENL DLSQVAAISNDLKSIRTQEKAQLQDLNDRFASFIE RVHELEQQNKVLEAELLVLRQKHSEPSRFRALYEQ EIRDLRLAAEDATNEKQALQGEREGLEETLRNLQA RYEEEVLSREDAEGRLMEARKGADEAALARAELEK RIDSLMDEISFLKKVHEEEIAELQAQIQYAQISVE MDVTKPDLSAALKDIRAQYEKLAAKNMQNAEEWFK SRFTVLTESAAKNTDAVRAAKDEVSESRRLLKAKT LEIEACRGMNEALEKQLQELEDKQNADISAMQDTI NKLENELRTTKSEMARYLKEYQDLLNVKMALDIEI AAYRKLLEGEETRLSFTSVGSITSGYSQSSQVFGR SAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEE TIEAAKAEEAKDEPPSEGEAEEEEKDKEEAEEEEA AEEEEAAKEESEEAKEEEEGGEGEEGEETKEAEEE EKKVEGAGEEQAAKKKD
Research Topic
others
Uniprot ID
P07196
Gene Names
NEFL
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region
2-543aa
MW of Fusion Proten
81, 4
Sequence Info
Full Length of Mature Protein
Relevance
Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber.
Reference
"The structure of a human neurofilament gene (NF-L): a unique exon-intron organization in the intermediate filament gene family."Julien J.-P., Grosveld F., Yazdanbaksh K., Flavell D., Meijer D., Mushynski W.Biochim. Biophys. Acta 909:10-20(1987)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 200ug
Available: In stock
Listprice: €546.07
Price: €546.07
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close