Comparison

Recombinant Human Neurofascin(NFASC),partial

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 100ug
Host E.coli
Item no. CSB-EP015743HU-100
Eclass 6.1 34160400
Eclass 9.0 42020190
Available
AA Sequence
KRSRGGKYPVREKKDVPLGPEDPKEEDGSFDYSDE DNKPLQGSQTSLDGTIKQQESDDSLVDYGEGGEGQ FNEDGSFIGQYTVKKDKEETEGNESSEATSPVNAI YSLA
Research Topic
Cell Adhesion
Uniprot ID
O94856
Gene Names
NFASC
Tag Info
N-terminal 6xHis-tagged
Expression Region
1239-1347aa
MW of Fusion Proten
15, 9
Sequence Info
Cytoplasmic Domain
Relevance
Cell adhesion, ankyrin-binding protein which may be involved in neurite extension, axonal guidance, synaptogenesis, myelination and neuron-glial cell interactions.
Reference
Myocilin mediates myelination in the peripheral nervous system through ErbB2/3 signaling.Kwon H.S., Johnson T.V., Joe M.K., Abu-Asab M., Zhang J., Chan C.C., Tomarev S.I.J. Biol. Chem. 288:26357-26371(2013)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Species
Homo sapiens (Human)
Amount: 100ug
Available: In stock
Listprice: €353.57
Price: €353.57
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close