Comparison

Recombinant Human Nuclear transcription factor Y subunit beta(NFYB)

Manufacturer Cusabio
Category
Type Proteins
Specific against other
Amount 500ug
Host E.coli
Item no. CSB-EP015774HU-500
eClass 6.1 34160400
eClass 9.0 42020190
Available
Research Topic
Signal Transduction
Uniprot ID
P25208
Gene Names
NFYB
Organism
Homo sapiens (Human)
AA Sequence
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDT EDSMNDHEDTNGSKESFREQDIYLPIANVARIMKN AIPQTGKIAKDAKECVQECVSEFISFITSEASERC HQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQK FREAMKGEKGIGGAVTATDGLSEELTEEAFTNQLP AGLITTDGQQQNVMVYTTSYQQISGVQQIQFS
Expression Region
1-207aa
Sequence Info
Full Length
Source
E.coli
Tag Info
N-terminal GST-tagged
MW
49.8 kDa
Alternative Name
CAAT box DNA-binding protein subunit B
Nuclear transcription factor Y subunit B
Relevance
Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors.
Reference
"Intron-exon organization of the NF-Y genes. Tissue-specific splicing modifies an activation domain."
Li X.-Y., Hooft van Huijsduijnen R., Mantovani R., Benoist C.O., Mathis D.
J. Biol. Chem. 267:8984-8990(1992)
Purity
Greater than 90% as determined by SDS-PAGE.
Storage Buffer
Tris-based buffer, 50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors.
Subcellular Location
Nucleus
Protein Families
NFYB/HAP3 subunit family
Paythway
Antigenprocessingandpresentation
Amount: 500ug
Available: In stock
Listprice: €1,440.76
Price: €1,440.76
lieferbar

Compare

Get an offer

Questions about this Product?
 
Close